PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00357.1_g00014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GRAS
Protein Properties Length: 560aa    MW: 62884 Da    PI: 4.8614
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00357.1_g00014.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS448.44.7e-1371925603374
                     GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                              + L++cA a+++g+ e+a++++++l++++s +gdp++R aay++eALaarla s+ +lykal+++e++   sse+l+a+++++ev+
  Sme2.5_00357.1_g00014.1 192 QMLFSCAAAIQDGNIEQASSMINELRQMVSIQGDPLERTAAYMVEALAARLATSGRGLYKALKCKEAT---SSERLSAMQVLFEVC 274
                              79*****************************************************************9...9************** PP

                     GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeel 172
                              P+++f++++aN aIlea++ e+rvHiiDfdi+qG Q+ +Llq+Las p++pp+lR+Tgv++pes+      l+ +g rLa++A+ l
  Sme2.5_00357.1_g00014.1 275 PYFRFGFMAANGAILEAFKDEKRVHIIDFDINQGSQYYTLLQTLASMPGKPPHLRLTGVDDPESVqrAIGGLNVIGLRLAELAKDL 360
                              ***************************************************************99777789*************** PP

                     GRAS 173 gvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfl 258
                              ++pfef++ v ++++ +++ +L+++pgEa+ Vn+++qlh+++desvs+ ++rd++L++vksl+Pk+v+vveq++++n+++Fl+rf+
  Sme2.5_00357.1_g00014.1 361 KIPFEFQA-VPSNTALVTPAMLNCRPGEAVLVNFAFQLHHMPDESVSTVNQRDQLLRMVKSLNPKLVTVVEQDMNTNTAPFLQRFA 445
                              ********.79*************************************************************************** PP

                     GRAS 259 ealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkv 344
                              e  +yy a+f+sl+a+l+r+s+er++vEr++l+r+i n+vaceg er+er e ++kWr+r+++aGF+p p+s ++ ++++ l++++
  Sme2.5_00357.1_g00014.1 446 EVYNYYCAVFESLDATLSRDSQERVNVERQCLARDIINIVACEGLERIERYEVAGKWRARMMMAGFTPCPISRNVFDSIQKLIKQY 531
                              ************************************************************************************** PP

                     GRAS 345 ksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                              +++ y+ +ee g+l++gW+d+ L+++SaW+
  Sme2.5_00357.1_g00014.1 532 SER-YKAKEEAGALYFGWEDKILTVASAWK 560
                              *66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.88164541IPR005202Transcription factor GRAS
PfamPF035141.6E-134192560IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MSLVRSLRSI ENGKLYFQNG HNDNPSLSTS MYTKNARGIM YATESSSTDS YDPKYLLDSP  60
SPSEELLNTS PTDVLGNPFH QRHSSSFQPS RDCNQVSYDS RDRVYQSPDS SEYNDGMVTM  120
KLQELEKVLF DDNEIEDDNV FARGETMDID GEWFNQIRTV LLQDSPKEST SADSNISSSS  180
SFAVTAPQTP KQMLFSCAAA IQDGNIEQAS SMINELRQMV SIQGDPLERT AAYMVEALAA  240
RLATSGRGLY KALKCKEATS SERLSAMQVL FEVCPYFRFG FMAANGAILE AFKDEKRVHI  300
IDFDINQGSQ YYTLLQTLAS MPGKPPHLRL TGVDDPESVQ RAIGGLNVIG LRLAELAKDL  360
KIPFEFQAVP SNTALVTPAM LNCRPGEAVL VNFAFQLHHM PDESVSTVNQ RDQLLRMVKS  420
LNPKLVTVVE QDMNTNTAPF LQRFAEVYNY YCAVFESLDA TLSRDSQERV NVERQCLARD  480
IINIVACEGL ERIERYEVAG KWRARMMMAG FTPCPISRNV FDSIQKLIKQ YSERYKAKEE  540
AGALYFGWED KILTVASAWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-601925606375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015073727.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_015073726.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_015073725.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLQ00LP30.0Q00LP3_SOLLC; GRAS6
STRINGSolyc04g064550.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA89672429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1